Drs
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 613545 | Complete | Structure prediction | Vincent_Lee | Drs | 44 | 23 Apr 2024 | 7 Jun 2024 |
1 . 10 . 20 . 30 . 40
sequence: DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 607766 | 1 | 1 | 0.92 | RoseTTAFold | 1-44 | 44 | 23 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington