E3G8Y6 Predict domains
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
613894 | Domain parse complete | Domain prediction | vvt | E3G8Y6 Predict domains | 168 | 24 Apr 2024 | 8 Jun 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 .
sequence: MSQTVHFQGNPVSVQGAIPHAGSKAPAFTLVAKDLSDVALSQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEMDNTVVLCISADLPFAQSRFCGAEGLSNVITLSTLRAPEFMQQYGVGIAEGALKGLAARAVVVIDENDNVVFSQLVNEITTEPDYTSALDVLKA
disopred: D-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
- | 1 | 1 | 0.94 | comparative modeling | 1-168 | 168 | - |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington