peptide pr

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
617454ActiveStructure prediction Madlin_Ashraf722002peptide pr9315 May 202429 Jun 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90   
   sequence: AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
61159911n/aRoseTTAFold1-939315 May 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington