ole e 1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
617832ActiveStructure prediction aaftabole e 114519 May 20243 Jul 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
   sequence: EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPNM
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
61196011n/aRoseTTAFold1-14514519 May 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington