Tokudaia muenninki SRY2 HMG Wt Robetta

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
620283CompleteStructure prediction billendary134Tokudaia muenninki SRY2 H...8011 Jun 20247 Aug 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
   sequence: HVKRPMNAFMVWSCGERRKLSQQNPSMHNTEISKQLGYRWKSLTEAEKRPFFQEAQRLKVLHREKYPNYKYQPHRRAKVP
   disopred: ----------------DDDDDDDDDDDDDDD---------------------------------------DDD-DDDDDD
      tmhmm: --------------------------------------------------------------------------------
| Download | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
61435611n/acomparative modeling1-808011 Jun 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington