WT alpha fold-HADDOCK.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
620310ActiveStructure prediction sfurutaWT alpha fold-HADDOCK.pdb22511 Jun 202426 Jul 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    
   sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCSALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
     chains: AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
   disopred: DDDDDDDDDDDDDD-------------------------------------------------------DDDDDDDDDDDD----------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------------------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
61438011n/acomparative modeling1-22422411 Jun 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington