2024-07-20_00000068_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 626435 | Complete | Structure prediction | RoseTTAFold | 2024-07-20_00000068_1_19 | 79 | 20 Jul 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: LYFQGAMCYIIAKRFKKSGCVALKAKRGKELADFATDLQKKLGYDIQIVAITRPTAYGEYEPYKFVNSFEEFSIEASRL
disopred: DDDD---------------------------------------------------------------------------
tmhmm: -------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 620507 | 1 | 1 | 0.79 | RoseTTAFold | 1-79 | 79 | 26 Jul 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington