yeeT.fasta
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
626462 | Complete | Structure prediction | vigneshsivaguru | yeeT.fasta | 73 | 20 Jul 2024 | 8 Sep 2024 (20:10:36) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
620180 | 1 | 1 | 0.86 | RoseTTAFold | 1-73 | 73 | 20 Jul 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington