ylcG.fasta
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 626477 | Expired | Structure prediction | vigneshsivaguru | ylcG.fasta | 46 | 20 Jul 2024 | 8 Sep 2024 |
1 . 10 . 20 . 30 . 40 .
sequence: MMFEFNMAELLRHRWGRLRLYRFLGSVLTDYRILKNYAKTLTGTGV
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 620195 | 1 | 1 | 0.80 | RoseTTAFold | 1-46 | 46 | 20 Jul 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington