Romo1
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
626680 | Complete | Structure prediction | saavidre | Romo1 | 79 | 23 Jul 2024 | 9 Sep 2024 (25:13:25) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: MPVAVGPYGQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKTMMQSGGTFGTFMAIGMGIRC
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
620272 | 1 | 1 | 0.74 | RoseTTAFold | 1-79 | 79 | 25 Jul 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington