2024-08-24_00000156_2_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 630049 | Complete | Structure prediction | RoseTTAFold | 2024-08-24_00000156_2_19 | 65 | 24 Aug 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: NEEEKFKFFVWFLAIRAGVPEVEVRNDNGKFQVTVKGDTDAARLLTKEVKEVATFLGVDVDLQIR
disopred: DDD--------------------------------------------------------------
tmhmm: -----------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 623900 | 1 | 1 | 0.91 | RoseTTAFold | 1-65 | 65 | 24 Aug 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington