st_P22452_S_1_rosettafold
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
634941 | Expired | Structure prediction | mdorn | st_P22452_S_1_rosettafold | 71 | 1 Oct 2024 | 15 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MKKNIAFLLASMFVFSIATNAYASTQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
628697 | 1 | 1 | 0.66 | RoseTTAFold | 1-71 | 71 | 1 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington