2024-10-05_00000262_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 635501 | Complete | Structure prediction | RoseTTAFold | 2024-10-05_00000262_1_19 | 34 | 5 Oct 2024 | - |
1 . 10 . 20 . 30
sequence: FVYVWKTWGQYWQVLGGPVSGLSIGTSRAMLGTH
disopred: -----------------------------D-DDD
tmhmm: ----------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 629251 | 1 | 1 | 0.74 | RoseTTAFold | 1-34 | 34 | 5 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington