2024-10-12_00000209_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 636421 | Complete | Structure prediction | RoseTTAFold | 2024-10-12_00000209_1_19 | 61 | 12 Oct 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: DDKAACADGIAAVKARVEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK
disopred: DDDD-------------DDDDDDDDDDDDDDDDDDDDDDDDD----------------DDD
tmhmm: -------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 630163 | 1 | 1 | 0.86 | RoseTTAFold | 1-61 | 61 | 12 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington