Chi_B_AP01148
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 636794 | Complete | Structure prediction | Vincent_Lee | Chi_B_AP01148 | 38 | 14 Oct 2024 | 28 Nov 2024 (14:25:28) |
1 . 10 . 20 . 30 .
sequence: IATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 630516 | 1 | 1 | 0.85 | RoseTTAFold | 1-38 | 38 | 14 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington