Cra_B_AP02618
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 636939 | Complete | Structure prediction | Vincent_Lee | Cra_B_AP02618 | 43 | 15 Oct 2024 | 29 Nov 2024 (34:38:45) |
1 . 10 . 20 . 30 . 40
sequence: GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 630660 | 1 | 1 | 0.86 | RoseTTAFold | 1-43 | 43 | 15 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington