Vic_B_AP00297
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 637035 | Expired | Structure prediction | Vincent_Lee | Vic_B_AP00297 | 47 | 16 Oct 2024 | 30 Nov 2024 |
1 . 10 . 20 . 30 . 40 .
sequence: LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 630754 | 1 | 1 | 0.90 | RoseTTAFold | 1-47 | 47 | 16 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington