Acy_A_AP03468
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 637073 | Complete | Structure prediction | Vincent_Lee | Acy_A_AP03468 | 50 | 16 Oct 2024 | 30 Nov 2024 (44:07:03) |
1 . 10 . 20 . 30 . 40 . 50
sequence: DFDPTEFKGPFPTIEICSKYCAVVCNYTSRPCYCVEAAKERDQWFPYCYD
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 630793 | 1 | 1 | 0.69 | RoseTTAFold | 1-50 | 50 | 16 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington