Cte_A_AP03018
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637087 | Complete | Structure prediction | Vincent_Lee | Cte_A_AP03018 | 67 | 16 Oct 2024 | 30 Nov 2024 (44:38:05) |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MKPQSILVLLVLAVLALHCKENEAASFPWTCASLSGVCRQGVCLPSELYFGSLGCGKGFLCCVSHFG
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630807 | 1 | 1 | 0.83 | RoseTTAFold | 1-67 | 67 | 16 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington