Cra_B_AP03611
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637110 | Expired | Structure prediction | Vincent_Lee | Cra_B_AP03611 | 93 | 16 Oct 2024 | 30 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYRYNIRRRENSYQRIRSDHDSHSCANNRGWCRPTCFSHEYTDWFNNDVCGSYRCCRPGRR
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630830 | 1 | 1 | 0.75 | RoseTTAFold | 1-93 | 93 | 16 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington