H avec peptide
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637247 | Complete | Structure prediction | bdamien | H avec peptide | 209 | 17 Oct 2024 | 1 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 .
sequence: MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRLHRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLETRTTNQFLAVSKGNCSQSQSNEEGFFFSARGHRPLD
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630957 | 1 | 1 | 0.48 | RoseTTAFold | 1-209 | 209 | 17 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington