0277
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637864 | Complete | Structure prediction | gsdsdt | 0277 | 100 | 22 Oct 2024 | 6 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: LSALAELADAVQSIVKNTIMLVAMAQLALRAGDFDKALELADQGLEMLKQAIENLQTAKAWCERKGREELRDAMDLALDEVREARREILDARDRLKKEKH
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
631542 | 1 | 1 | 0.84 | RoseTTAFold | 1-100 | 100 | 22 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington