4YU4_1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 638450 | Complete | Structure prediction | 18945269928 | 4YU4_1 | 141 | 25 Oct 2024 | 9 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140
sequence: VLSPADKTNIKASWEKIGSHGGEYGAEALERTFLCFPTTKTYFPHFDLSHGSAQVKAHGKKVADALTNAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFLSSVSTVLTSKYR
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632103 | 1 | 1 | 0.93 | RoseTTAFold | 1-141 | 141 | 25 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington