3I3Z_1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 638464 | Complete | Structure prediction | Cui Huijing | 3I3Z_1 | 30 | 25 Oct 2024 | 9 Dec 2024 |
1 . 10 . 20 . 30
sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 632121 | 1 | 1 | 0.83 | RoseTTAFold | 1-30 | 30 | 25 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington