MN608_11100
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 638498 | Complete | Structure prediction | Natalia_Al-QAZ | MN608_11100 | 139 | 25 Oct 2024 | 10 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: MKTSFALASLLFVAGSALALPTDPHPPTTPTYPPGGGNGGGGNGGGGNGGGGNGGGGNGGGGNGGGSNNYIACTGLYSAPKCCATDVLGVADLDCAAPGAVLTSGPNFAAVCATKGQRARCCVIPVLGQAVLCRTPNNL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632154 | 1 | 1 | 0.62 | RoseTTAFold | 1-139 | 139 | 25 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington