3B2M_gai2_PMNN_2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 638528 | Complete | Structure prediction | houzhiqi | 3B2M_gai2_PMNN_2 | 129 | 26 Oct 2024 | 10 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
sequence: GNSTEQETSTTETQLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPQGVDYVVTEDDYKSEKYTTNVEKSKQAGKMTITFTNKKVF
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632188 | 1 | 1 | 0.89 | RoseTTAFold | 1-129 | 129 | 26 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington