GLP1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 638598 | Complete | Structure prediction | beatriz18 | GLP1 | 31 | 26 Oct 2024 | 10 Dec 2024 |
1 . 10 . 20 . 30
sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 632255 | 1 | 1 | 0.89 | RoseTTAFold | 1-31 | 31 | 26 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington