MN608_04182
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
638648 | Complete | Structure prediction | aminto | MN608_04182 | 85 | 27 Oct 2024 | 11 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: APAVDVVESRQVPYVPCSGLYNNAVCCATDVLNLADLDCANPTRVVTDPSDFQAACATDGQRARCCLLPVLGQAVLCQTPAGISQ
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
632301 | 1 | 1 | 0.75 | RoseTTAFold | 1-85 | 85 | 27 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington