line_7b
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 639101 | Complete | Structure prediction | katafotic | line_7b | 60 | 30 Oct 2024 | 14 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: STVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 632724 | 1 | 1 | 0.75 | RoseTTAFold | 1-60 | 60 | 30 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington