4JHU
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
639222 | Complete | Structure prediction | amorales | 4JHU | 47 | 31 Oct 2024 | 15 Dec 2024 |
1 . 10 . 20 . 30 . 40 .
sequence: HWHGFFQAGTSWADGPAFVTQCPIASGDSFLYDFRARDQAGTFWYHS
disopred: -----------------------------------------------
tmhmm: -----------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
632842 | 1 | 1 | n/a | comparative modeling | 1-47 | 47 | 31 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington