Bacterioferritin-associated ferredoxin rosettfold
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
639226 | Complete | Structure prediction | SianD | Bacterioferritin-associat... | 72 | 31 Oct 2024 | 15 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MLMYVCLCVGVTNQTVCDAVARGASTSKEVAAVCGAGGDCGRCRRTLRAIIAAARLNPTQLDPAGRTSDAVC
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
632844 | 1 | 1 | 0.81 | RoseTTAFold | 1-72 | 72 | 31 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington