8uc4-PLE-1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639279 | Complete | Structure prediction | gsdsdt | 8uc4-PLE-1 | 164 | 31 Oct 2024 | 15 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160
sequence: ANPVLYFDVAADGVPLGRIEVELHRDVNPVLAENFETLASGKAGSGFNGGHFHRVIPGFRVEAGDTVTHDGTGGKSVYGDTFPIPSYELKAEGPGDFLAATDGEDTVRSQFFIATAALPWLDGKHPVFGRVLRGLEVVRKIDELGSESGEAKRRITITDSGILK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632898 | 1 | 1 | 0.93 | RoseTTAFold | 1-164 | 164 | 31 Oct 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington