0089-PLE-2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 640622 | Complete | Structure prediction | gsdsdt | 0089-PLE-2 | 100 | 7 Nov 2024 | 22 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: KTYKEIAKEVVERVLKELGLKDVEITSMKVEEFEEEGEKVIKVTAKAKATVDGKDYSIDIDLTMRITKDGDIEIELDITLTTEGGKVEKKSLKLKIKKSE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 634219 | 1 | 1 | 0.91 | RoseTTAFold | 1-100 | 100 | 7 Nov 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington