IRX3_ring finger_1weo.pdb
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 640971 | Complete | Structure prediction | slc1916 | IRX3_ring finger_1weo.pdb | 68 | 9 Nov 2024 | 24 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MMESGAPICHTCGEQVGHDANGELFVACHECNYPMCKSCFEFEIKEGRKVCLRCGSPYDENLLDDVEK
disopred: DDDDD--DDD----------------------------------------------DDDDDDDDDDDD
tmhmm: --------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 634564 | 1 | 1 | n/a | comparative modeling | 1-68 | 68 | 9 Nov 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington