Gallus gallus proximal barbule cell factor PBCF type 1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
641279CompleteStructure prediction LathreasGallus gallus proximal ba...10810 Nov 202425 Dec 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .   
   sequence: MAIFSAALALILVNLLKAQGTPVPPVLEETSVEQSSDLNMQPSSKIPVEYSRDPYKEEGVEKTGNTGVQECEQATWEISGEPSTETTPNSSVESNKEQTQKPTTEVSE
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
634868110.66RoseTTAFold1-10810810 Nov 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington