SSP7Stiggcut
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
641511 | Error | Structure prediction | debabratadutta66 | SSP7Stiggcut | 91 | 11 Nov 2024 | 26 Dec 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: AVTDASARLLQFAKQERSTSENCLCSPATWWCCPPASGVAKPSEDCLCSPATWWCCPPASGVAKPSEDCLCSPATWFCCPEASGVAKPSED
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
635097 | 1 | 1 | n/a | RoseTTAFold | 1-91 | 91 | 11 Nov 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington