N78-118
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 646843 | Complete | Structure prediction | 23720589 | N78-118 | 41 | 3 Dec 2024 | 17 Jan 2025 |
1 . 10 . 20 . 30 . 40
sequence: RKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELEN
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 640342 | 1 | 1 | 0.94 | RoseTTAFold | 1-41 | 41 | 3 Dec 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington