Y130A
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
648601 | Complete | Structure prediction | zxlyolanda | Y130A | 138 | 12 Dec 2024 | 26 Jan 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: HITLLEPAPRHDQQKLGPCGAGTDDARGEVVSTFRPGQTITVRWQETVPHPGYFRISFDDEGQDAFVDPPEAGQSGDPAVVLVDLVADKDGRQTYEQAVTLPDVRCDRCTLQLVQVMTDKAPYGDGNDLAYQCADLVL
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
642032 | 1 | 1 | 0.73 | RoseTTAFold | 1-138 | 138 | 12 Dec 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington