2021-03-27_00000127_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 65151 | Complete | Structure prediction | cameo | 2021-03-27_00000127_2_11 | 38 | 27 Mar 2021 | - |
1 . 10 . 20 . 30 .
sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
disopred: DDD------------------DDDDDDDDDDDDDDDDD
tmhmm: --------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 63358 | 1 | 1 | 0.72 | TrRefineRosetta | 1-38 | 38 | 27 Mar 2021 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington