Short transmembrane mitochondrial protein 1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 651530 | Complete | Structure prediction | alireza99722 | Short transmembrane mitoc... | 45 | 1 Jan 2025 | 20 Feb 2025 (06:57:41) |
1 . 10 . 20 . 30 . 40 .
sequence: MLQFLLGFTLGNVVGMYLAQNYDGIGSPSVSQAGVQWWDLGSLQL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 644827 | 1 | 1 | 0.79 | RoseTTAFold | 1-45 | 45 | 6 Jan 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington