4QQ6_1
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 651678 | Complete | Structure prediction | auriane | 4QQ6_1 | 67 | 3 Jan 2025 | 21 Feb 2025 (13:18:37) |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: GKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 644880 | 1 | 1 | 0.81 | RoseTTAFold | 1-67 | 67 | 6 Jan 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington