0765
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 653172 | Complete | Structure prediction | palefire | 0765 | 69 | 11 Jan 2025 | 25 Feb 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MVTTIKRDPMRFLRELKKHYDVVMRIPGSEYLKSPDFVVVDPKTGKKLKVSFVTLDDGELAGVVYDSIS
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 646449 | 1 | 1 | 0.72 | RoseTTAFold | 1-69 | 69 | 11 Jan 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington