1ahq-19kv2
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
654128 | Complete | Structure prediction | gsdsdt | 1ahq-19kv2 | 133 | 15 Jan 2025 | 1 Mar 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130
sequence: MIKVSGETIKAAGLMLEGNSYRFVLFVLDGEGSAFVTLLLGPRDATLEDVRKNIPPNASAFAIVRIRFDLGGGGGVVPVFLYWAPEGADPEGLNLLSNSADLVLSALKGDQVIVLASNDDERSPGYLVGKALG
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
647387 | 1 | 1 | 0.87 | RoseTTAFold | 1-133 | 133 | 15 Jan 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington