1ajg-19kv3
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
654133 | Complete | Structure prediction | gsdsdt | 1ajg-19kv3 | 153 | 15 Jan 2025 | 1 Mar 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
sequence: GISPEDLGLVLKVLEKVLKDREGCGGDTLINMVENNPEIRDLFKEFDHAKTKEELLKSKDGRELGLVILGLLLGAFKSGGNFKGYLKILGRYGLLELQVPIGFWYAIGGALLLVLSEYFPDVMGEEVQNALLKGLSYLIDLLRKYYKKGGYGG
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
647392 | 1 | 1 | 0.89 | RoseTTAFold | 1-153 | 153 | 15 Jan 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington