2025-02-01_00000077_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 656327 | Error | Structure prediction | cameo | 2025-02-01_00000077_2_11 | 56 | 1 Feb 2025 | - |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: SLEEEAERVVEELVKEFNLSRTQEIALRRYAEYAARATASEEVIEELLRDVAERLS
disopred: DDDDDD-DD---------------------------------------------DD
tmhmm: --------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 649517 | 1 | 1 | n/a | TrRefineRosetta | 1-56 | 56 | 1 Feb 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington