Ha41
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 656966 | Complete | Structure prediction | Zhusy | Ha41 | 41 | 7 Feb 2025 | 24 Mar 2025 |
1 . 10 . 20 . 30 . 40
sequence: VAGSPFVRAQQRGRRYVHRPIYKQYQPQAHKSRRVFAFLSR
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 650092 | 1 | 1 | 0.83 | RoseTTAFold | 1-41 | 41 | 7 Feb 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington