trp32_ag2_l2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 663662 | Complete | Structure prediction | Liza_Alex | trp32_ag2_l2 | 88 | 26 Mar 2025 | 18 May 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: MLYKMRINMLQISERNLQGSPQIELPNSSQEIQLSDIDKRVSVDPYELGEAAAKDCCYDPSCYFDYTASDCCVRPKMQDNLLQEYSES
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 656547 | 1 | 1 | 0.56 | RoseTTAFold | 1-88 | 88 | 3 Apr 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington