Affibody 3D Structure
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 663687 | Complete | Structure prediction | Arghavani | Affibody 3D Structure | 58 | 26 Mar 2025 | 18 May 2025 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: AEAKYAKEKYNAYYEIWQLPNLTKYQKAAFIGKLQDDPSQSSELLSEAKKLNDSQAPK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 656190 | 1 | 1 | 0.94 | RoseTTAFold | 1-58 | 58 | 3 Apr 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington