Assignment
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 664242 | Active | Structure prediction | karthicks21 | Assignment | 67 | 2 Apr 2025 | 18 May 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: HNCILYTEGCRWGLIPNMNLNDVRDWWRYWWPMGPLLLHEWTSLKPPNWPLPEPESYTLLFHLEWYL
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 656757 | 1 | 1 | n/a | RoseTTAFold | 1-67 | 67 | 3 Apr 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington