2025-05-03_00000026_full_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 668106 | Error | Structure prediction | cameo | 2025-05-03_00000026_full_... | 31 | 3 May 2025 | - |
1 . 10 . 20 . 30
sequence: GFCWGDLCVPYGTCSQLPPWLQDMCAAASFD
disopred: ----------------------------D-D
tmhmm: -------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 660537 | 1 | 1 | n/a | TrRefineRosetta | 1-31 | 31 | 3 May 2025 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington